PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.8U1PN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 88aa    MW: 10021 Da    PI: 4.5318
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.8U1PNgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-103373244
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     + ++++E++l ++ +++ G++ W++Ia +++ gRt+ ++  +w
      Aradu.8U1PN 33 LEFSEDEEDLVARMFRLVGKR-WSLIAGRIP-GRTAQEIEKYW 73
                     579******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.5E-63179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-123475IPR009057Homeodomain-like
CDDcd001676.60E-83473No hitNo description
PfamPF002491.7E-93473IPR001005SANT/Myb domain
PROSITE profilePS500906.623577IPR017877Myb-like domain
SuperFamilySSF466894.73E-83575IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MSDSNHHSTT EANTASSDQF VKEMRQEEEP TMLEFSEDEE DLVARMFRLV GKRWSLIAGR  60
IPGRTAQEIE KYWSSKCAFP SDQCSSSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016196430.11e-60PREDICTED: MYB-like transcription factor ETC3
RefseqXP_015958601.11e-60PREDICTED: MYB-like transcription factor ETC3
SwissprotQ9M1578e-18ETC3_ARATH; MYB-like transcription factor ETC3
TrEMBLU5GK035e-24U5GK03_POPTR; Uncharacterized protein
STRINGPOPTR_0004s02060.11e-23(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01060.35e-19CAPRICE-like MYB3